PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.WL1JB
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 309aa    MW: 35778.7 Da    PI: 7.1899
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.WL1JBgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like83.52.3e-26169223155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k r+rWt++LHe F+ +v++LGG++kA Pk+il++mk + L+++h+kSHLQkYR+
  Araip.WL1JB 169 KRRIRWTKDLHEPFMTVVNRLGGPHKAKPKAILDMMKSDLLSITHIKSHLQKYRS 223
                  68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-23168224IPR009057Homeodomain-like
SuperFamilySSF466893.05E-13168224IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-21169223IPR006447Myb domain, plants
PfamPF002496.1E-6173222IPR001005SANT/Myb domain
PfamPF143791.4E-6254300IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MYQYLYGSSS GECWEQGQSS YEPYYDEVPA SAWNFELPLT TGTVVDAVES SSISSSSADS  60
YSSYERCNTI PSSYSDVAAN DVLIFHQHYP QQHHVHSNKL LIGDDHDQYD ATDHHEKPLQ  120
ICFQTNQGNS FTNHTLYIWS KTEKQGYVSG SSNCGYRRGP SSSSSSSIKR RIRWTKDLHE  180
PFMTVVNRLG GPHKAKPKAI LDMMKSDLLS ITHIKSHLQK YRSTIWHHKA SHERSFEEGD  240
KTDVTHQLQH KIQIQIEESQ QLQQEVRRSI HQQLEMQRTL QMLIEQQREQ LKMMLDQQKE  300
RNKSGKEIK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016207445.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X2
TrEMBLK7MYF64e-65K7MYF6_SOYBN; Uncharacterized protein
STRINGGLYMA19G32841.11e-64(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144901016
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.14e-31G2-like family protein